Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Immunoglobulin heavy variable 4-30-2 (HV432), Biotinylated

This Recombinant Human Immunoglobulin heavy variable 4-30-2 (HV432), Biotinylated spans the amino acid sequence from region 20-118. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Immunoglobulin heavy variable 4-30-2 IGHV4-30-2

UniProt

A0A087WSY4

Expression Region

20-118

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

QLQLQESGSGLVKPSQTLSLTCAVSGGSISSGGYSWSWIRQPPGKGLEWIGYIYHSGSTYYNPSLKSRVTISVDRSKNQFSLKLSSVTAADTAVYYCAR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TPRA1 (NM_001136053) Human Tagged ORF Clone Lentiviral Particle
RC227379L3V 200 µL

TPRA1 (NM_001136053) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
Olr1686 (NM_001001373) Rat Tagged ORF Clone Lentiviral Particle
RR206881L4V 200 µL

Olr1686 (NM_001001373) Rat Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
RNF10 Antibody
DF14944-01 100 µL

RNF10 Antibody

Sign In for Pricing
View Details
RNF10 Antibody
DF14944-02 200 µL

RNF10 Antibody

Sign In for Pricing
View Details
Granzyme B Rabbit Polyclonal Antibody, 1 pack = 100 µL
BAL5175 1 Each

Granzyme B Rabbit Polyclonal Antibody, 1 pack = 100 µL

Sign In for Pricing
View Details
3-Acetyl-1,2-O-isopropylidene-6-O-trityl-α-D-galactofuranose
TSW-00684-01 100 mg

3-Acetyl-1,2-O-isopropylidene-6-O-trityl-α-D-galactofuranose

Sign In for Pricing
View Details