Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Immunoglobulin kappa variable 3D-15 (KVD15), Biotinylated

This Recombinant Human Immunoglobulin kappa variable 3D-15 (KVD15), Biotinylated spans the amino acid sequence from region 21-115. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Immunoglobulin kappa variable 3D-15 IGKV3D-15

UniProt

A0A087WSY6

Expression Region

21-115

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

EIVMTQSPATLSVSPGERATLSCRASQSVSSNLAWYQQKPGQAPRLLIYGASIRATGIPARFSGSGSGTEFTLTISILQSEDFAVYYCQQYNNWP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human TNF alpha Recombinant Rabbit monoclonal Antibody
HA750593 100 µL

Human TNF alpha Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details
CD50 (ICAM-3) (101-1D2), 1mg/mL
BNUM0177-50 1x 50 µL

CD50 (ICAM-3) (101-1D2), 1mg/mL

Sign In for Pricing
View Details
Dylight 488 Conjugated Limax flavus Lectin (Garden Slug) -LFA-
DY488-5101-1 1 mg

Dylight 488 Conjugated Limax flavus Lectin (Garden Slug) -LFA-

Sign In for Pricing
View Details
Recombinant Human FGF23 (Arg179Gln) Protein (His Tag)
PDMH100467-01 20 µg

Recombinant Human FGF23 (Arg179Gln) Protein (His Tag)

Sign In for Pricing
View Details
Recombinant Human FGF23 (Arg179Gln) Protein (His Tag)
PDMH100467-02 100 µg

Recombinant Human FGF23 (Arg179Gln) Protein (His Tag)

Sign In for Pricing
View Details
Recombinant Human FGF23 (Arg179Gln) Protein (His Tag)
PDMH100467-03 500 µg

Recombinant Human FGF23 (Arg179Gln) Protein (His Tag)

Sign In for Pricing
View Details