Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Immunoglobulin kappa variable 3D-15 (KVD15), Biotinylated

This Recombinant Human Immunoglobulin kappa variable 3D-15 (KVD15), Biotinylated spans the amino acid sequence from region 21-115. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Immunoglobulin kappa variable 3D-15 IGKV3D-15

UniProt

A0A087WSY6

Expression Region

21-115

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

EIVMTQSPATLSVSPGERATLSCRASQSVSSNLAWYQQKPGQAPRLLIYGASIRATGIPARFSGSGSGTEFTLTISILQSEDFAVYYCQQYNNWP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Chromogranin A / CHGA (Neuroendocrine Marker) (CHGA/1731R), CF640R conjugate, 0.1mg/mL
BNC401731-100 1x 100 µL

Chromogranin A / CHGA (Neuroendocrine Marker) (CHGA/1731R), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Frozen Tissue Sections, Ovary
CS622502 5x 5 µm

Frozen Tissue Sections, Ovary

Sign In for Pricing
View Details
RPS4Y1 (Center) Rabbit Polyclonal Antibody
AP53741PU-N 400 µL

RPS4Y1 (Center) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
CD34 (HPCA1/1171), CF647 conjugate, 0.1mg/mL
BNC471171-500 1x 500 µL

CD34 (HPCA1/1171), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
ACTH (Adrenocorticotrophic Hormone) (Pituitary Marker) (CLIP/2040R), CF405S conjugate, 0.1mg/mL
BNC042040-100 1x 100 µL

ACTH (Adrenocorticotrophic Hormone) (Pituitary Marker) (CLIP/2040R), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Human SELS (SELENOS) activation kit by CRISPRa
GA111002 1 Kit

Human SELS (SELENOS) activation kit by CRISPRa

Sign In for Pricing
View Details