Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Immunoglobulin kappa variable 3D-15 (KVD15), Biotinylated

This Recombinant Human Immunoglobulin kappa variable 3D-15 (KVD15), Biotinylated spans the amino acid sequence from region 21-115. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Immunoglobulin kappa variable 3D-15 IGKV3D-15

UniProt

A0A087WSY6

Expression Region

21-115

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

EIVMTQSPATLSVSPGERATLSCRASQSVSSNLAWYQQKPGQAPRLLIYGASIRATGIPARFSGSGSGTEFTLTISILQSEDFAVYYCQQYNNWP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Metalloproteinase Inhibitor 2 Antibody
RC-15553-01 50 μL

Recombinant Metalloproteinase Inhibitor 2 Antibody

Sign In for Pricing
View Details
Recombinant Metalloproteinase Inhibitor 2 Antibody
RC-15553-02 100 µL

Recombinant Metalloproteinase Inhibitor 2 Antibody

Sign In for Pricing
View Details
Recombinant Metalloproteinase Inhibitor 2 Antibody
RC-15553-03 1 mL

Recombinant Metalloproteinase Inhibitor 2 Antibody

Sign In for Pricing
View Details
COLEC10 Human Gene Knockout Kit (CRISPR)
KN420039 1 Kit

COLEC10 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
SCFD1 Mouse Monoclonal Antibody [Clone ID: OTI10D10]
CF808451 100 µg

SCFD1 Mouse Monoclonal Antibody [Clone ID: OTI10D10]

Sign In for Pricing
View Details
PE/iFluor® 700 Anti-human CD19 Antibody *HIB19*
101921X0-AAT 25 Tests

PE/iFluor® 700 Anti-human CD19 Antibody *HIB19*

Sign In for Pricing
View Details