Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Immunoglobulin kappa variable 3D-15 (KVD15), Biotinylated

This Recombinant Human Immunoglobulin kappa variable 3D-15 (KVD15), Biotinylated spans the amino acid sequence from region 21-115. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Immunoglobulin kappa variable 3D-15 IGKV3D-15

UniProt

A0A087WSY6

Expression Region

21-115

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

EIVMTQSPATLSVSPGERATLSCRASQSVSSNLAWYQQKPGQAPRLLIYGASIRATGIPARFSGSGSGTEFTLTISILQSEDFAVYYCQQYNNWP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

DOK4
522349-01 100 µL

DOK4

Sign In for Pricing
View Details
DOK4
522349-02 200 µL

DOK4

Sign In for Pricing
View Details
Recombinant Human HNRNPL Protein, His, Yeast-10ug
QP9182-ye-10ug 10ug

Recombinant Human HNRNPL Protein, His, Yeast-10ug

Sign In for Pricing
View Details
5430419D17Rik shRNA (m) Lentiviral Particles
sc-140362-V 200 µL

5430419D17Rik shRNA (m) Lentiviral Particles

Sign In for Pricing
View Details
Hepatocyte Nuclear Factor 4 gamma (HNF4 gamma, HNF-4-gamma, HNF4g, Nuclear Receptor Subfamily 2 Group A Member 2, NR2A2) (MaxLight 490) discontinued
H2006-11B-ML490 100 µL

Hepatocyte Nuclear Factor 4 gamma (HNF4 gamma, HNF-4-gamma, HNF4g, Nuclear Receptor Subfamily 2 Group A Member 2, NR2A2) (MaxLight 490) discontinued

Sign In for Pricing
View Details
ASXL2 (NM_018263) Human Over-expression Lysate
LH10667V 100 µg

ASXL2 (NM_018263) Human Over-expression Lysate

Sign In for Pricing
View Details