Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Immunoglobulin kappa variable 1D-8 (KVD08), Biotinylated

This Recombinant Human Immunoglobulin kappa variable 1D-8 (KVD08), Biotinylated spans the amino acid sequence from region 23-117. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Immunoglobulin kappa variable 1D-8 IGKV1D-8

UniProt

A0A087WSZ0

Expression Region

23-117

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

AIWMTQSPSLLSASTGDRVTISCRMSQGISSYLAWYQQKPGKAPELLIYAASTLQSGVPSRFSGSGSGTDFTLTISCLQSEDFATYYCQQYYSFP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Glove Box Holder Wire 3 Box
SAF2152 1 Each

Glove Box Holder Wire 3 Box

Sign In for Pricing
View Details
PALM Knockout NCI-H1975 Polyclonal Cells
ARG17210 1 Million

PALM Knockout NCI-H1975 Polyclonal Cells

Sign In for Pricing
View Details
Rabbit Polyclonal Butyrylcholinesterase/BCHE Antibody [PerCP]
NBP2-98274PCP 0.1 mL

Rabbit Polyclonal Butyrylcholinesterase/BCHE Antibody [PerCP]

Sign In for Pricing
View Details
Avian HEV Capsid Polyclonal Antibody
orb3149040-01 50 µg

Avian HEV Capsid Polyclonal Antibody

Sign In for Pricing
View Details
Avian HEV Capsid Polyclonal Antibody
orb3149040-02 100 µg

Avian HEV Capsid Polyclonal Antibody

Sign In for Pricing
View Details
Rabbit Polyclonal KRT84 Antibody
NBP2-85174-0.1mL 0.1 mL

Rabbit Polyclonal KRT84 Antibody

Sign In for Pricing
View Details