Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Immunoglobulin kappa variable 1D-8 (KVD08), Biotinylated

This Recombinant Human Immunoglobulin kappa variable 1D-8 (KVD08), Biotinylated spans the amino acid sequence from region 23-117. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Immunoglobulin kappa variable 1D-8 IGKV1D-8

UniProt

A0A087WSZ0

Expression Region

23-117

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

AIWMTQSPSLLSASTGDRVTISCRMSQGISSYLAWYQQKPGKAPELLIYAASTLQSGVPSRFSGSGSGTDFTLTISCLQSEDFATYYCQQYYSFP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-CD1B Antibody Picoband®, Dylight594 Conjugate
A02158-2-Dylight594 100 µg

Anti-CD1B Antibody Picoband®, Dylight594 Conjugate

Sign In for Pricing
View Details
Recombinant C. trachomatis outer membrane porin, serovar A Protein, His-SUMO, E.coli-500ug
QP7129-500ug 500ug

Recombinant C. trachomatis outer membrane porin, serovar A Protein, His-SUMO, E.coli-500ug

Sign In for Pricing
View Details
GNPDA2 Blocking Peptide
NBP1-76997PEP 0.05 mg

GNPDA2 Blocking Peptide

Sign In for Pricing
View Details
Acbd5 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 1)
K4049406 1.0 µg DNA

Acbd5 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 1)

Sign In for Pricing
View Details
Rabbit Polyclonal CTRP9/C1qTNF9 Antibody
NBP2-46834-25ul 25 µL

Rabbit Polyclonal CTRP9/C1qTNF9 Antibody

Sign In for Pricing
View Details
RMND1 Lentiviral Vector (Human) (EF1a) (pLenti-GIII-EF1a)
LV703850 1.0 µg DNA

RMND1 Lentiviral Vector (Human) (EF1a) (pLenti-GIII-EF1a)

Sign In for Pricing
View Details