Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor alpha variable 30 (TVA30), Biotinylated

This Recombinant Human T cell receptor alpha variable 30 (TVA30), Biotinylated spans the amino acid sequence from region 22-112. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor alpha variable 30 TRAV30

UniProt

A0A087WSZ9

Expression Region

22-112

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

QQPVQSPQAVILREGEDAVINCSSSKALYSVHWYRQKHGEAPVFLMILLKGGEQKGHDKISASFNEKKQQSSLYLTASQLSYSGTYFCGTE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

pLV3-U6-LRG1-shRNA3-CopGFP-Puro Plasmid
PVT47264 2 µg

pLV3-U6-LRG1-shRNA3-CopGFP-Puro Plasmid

Sign In for Pricing
View Details
Nck (NCK1, NCK adaptor protein 1, Cytoplasmic protein NCK1, MGC12668, Nck-1, NCKalpha, SH2/SH3 adaptor protein NCK-alpha) (FITC)
MBS6489465-01 0.1 mL

Nck (NCK1, NCK adaptor protein 1, Cytoplasmic protein NCK1, MGC12668, Nck-1, NCKalpha, SH2/SH3 adaptor protein NCK-alpha) (FITC)

Sign In for Pricing
View Details
Nck (NCK1, NCK adaptor protein 1, Cytoplasmic protein NCK1, MGC12668, Nck-1, NCKalpha, SH2/SH3 adaptor protein NCK-alpha) (FITC)
MBS6489465-02 5x 0.1 mL

Nck (NCK1, NCK adaptor protein 1, Cytoplasmic protein NCK1, MGC12668, Nck-1, NCKalpha, SH2/SH3 adaptor protein NCK-alpha) (FITC)

Sign In for Pricing
View Details
SOD3, NT (Extracellular Superoxide Dismutase [Cu-Zn], EC-SOD) (MaxLight 750)
MBS6501656-01 0.1 mL

SOD3, NT (Extracellular Superoxide Dismutase [Cu-Zn], EC-SOD) (MaxLight 750)

Sign In for Pricing
View Details
SOD3, NT (Extracellular Superoxide Dismutase [Cu-Zn], EC-SOD) (MaxLight 750)
MBS6501656-02 5x 0.1 mL

SOD3, NT (Extracellular Superoxide Dismutase [Cu-Zn], EC-SOD) (MaxLight 750)

Sign In for Pricing
View Details
Elac1 (NM_001107406) Rat Tagged Lenti ORF Clone
RR209706L4 10 µg

Elac1 (NM_001107406) Rat Tagged Lenti ORF Clone

Sign In for Pricing
View Details