Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor alpha variable 9-2 (TVA92), Biotinylated

This Recombinant Human T cell receptor alpha variable 9-2 (TVA92), Biotinylated spans the amino acid sequence from region 21-112. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor alpha variable 9-2 TRAV9-2

UniProt

A0A087WT02

Expression Region

21-112

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

DSVTQMEGPVTLSEEAFLTINCTYTATGYPSLFWYVQYPGEGLQLLLKATKADDKGSNKGFEATYRKETTSFHLEKGSVQVSDSAVYFCALS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD9 (TSPAN29) (Motility-Related Protein-1) (CD9/1631), CF647 conjugate, 0.1mg/mL
BNC471631-500 1x 500 µL

CD9 (TSPAN29) (Motility-Related Protein-1) (CD9/1631), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Tissue Total RNA, Esophagus
CR560554 5 µg

Tissue Total RNA, Esophagus

Sign In for Pricing
View Details
Tissue FFPE Sections, Breast
CS713798 5x 5 µm

Tissue FFPE Sections, Breast

Sign In for Pricing
View Details
PCTP (NM_001102402) Human Recombinant Protein
TP321070 20 µg

PCTP (NM_001102402) Human Recombinant Protein

Sign In for Pricing
View Details
Parathyroid Hormone (PTH) (N-Terminal) (rPTH/911), Biotin conjugate, 0.1mg/mL
BNCB1899-500 1x 500 µL

Parathyroid Hormone (PTH) (N-Terminal) (rPTH/911), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details
PGP9.5 (UCHL1) (58-68) Goat Polyclonal Antibody
AP21291PU-N 100 µg

PGP9.5 (UCHL1) (58-68) Goat Polyclonal Antibody

Sign In for Pricing
View Details