Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor alpha variable 9-2 (TVA92), Biotinylated

This Recombinant Human T cell receptor alpha variable 9-2 (TVA92), Biotinylated spans the amino acid sequence from region 21-112. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor alpha variable 9-2 TRAV9-2

UniProt

A0A087WT02

Expression Region

21-112

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

DSVTQMEGPVTLSEEAFLTINCTYTATGYPSLFWYVQYPGEGLQLLLKATKADDKGSNKGFEATYRKETTSFHLEKGSVQVSDSAVYFCALS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human KLHL6 activation kit by CRISPRa
GA113943 1 Kit

Human KLHL6 activation kit by CRISPRa

Sign In for Pricing
View Details
p-Cyanoacetophenone-d4
TRC-C987507-10MG 10 mg

p-Cyanoacetophenone-d4

Sign In for Pricing
View Details
PTER Mouse Monoclonal Antibody [Clone ID: OTI2F9]
CF813177 100 µg

PTER Mouse Monoclonal Antibody [Clone ID: OTI2F9]

Sign In for Pricing
View Details
LRRC25 Antibody
KC-48275-01 50 μL

LRRC25 Antibody

Sign In for Pricing
View Details
LRRC25 Antibody
KC-48275-02 100 µL

LRRC25 Antibody

Sign In for Pricing
View Details
LRRC25 Antibody
KC-48275-03 1 mL

LRRC25 Antibody

Sign In for Pricing
View Details