Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor alpha variable 26-1 (TVAZ1), Biotinylated

This Recombinant Human T cell receptor alpha variable 26-1 (TVAZ1), Biotinylated spans the amino acid sequence from region 20-109. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor alpha variable 26-1 TRAV26-1

UniProt

A0A087WT03

Expression Region

20-109

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

KTTQPTSMDCAEGRAANLPCNHSTISGNEYVYWYRQIHSQGPQYIIHGLKNNETNEMASLIITEDRKSSTLILPHATLRDTAVYYCIVRV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cbfb sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 3)
K7289008 1.0 µg DNA

Cbfb sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 3)

Sign In for Pricing
View Details
COL5A2 Antibody
A19725-100UG 100 µg

COL5A2 Antibody

Sign In for Pricing
View Details
MMP13 Polyclonal Antibody, PE-Cy5 Conjugated
bs-10581R-PE-Cy5-TR 20 µL

MMP13 Polyclonal Antibody, PE-Cy5 Conjugated

Sign In for Pricing
View Details
Recombinant Human CD301/CLEC10A Protein, N-His
AP92548 50 µg

Recombinant Human CD301/CLEC10A Protein, N-His

Sign In for Pricing
View Details
PGP, NT (PGP, Phosphoglycolate phosphatase) (PE)
MBS6333111-01 0.2 mL

PGP, NT (PGP, Phosphoglycolate phosphatase) (PE)

Sign In for Pricing
View Details
PGP, NT (PGP, Phosphoglycolate phosphatase) (PE)
MBS6333111-02 5x 0.2 mL

PGP, NT (PGP, Phosphoglycolate phosphatase) (PE)

Sign In for Pricing
View Details