Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor beta variable 16 (TVB16), Biotinylated

This Recombinant Human T cell receptor beta variable 16 (TVB16), Biotinylated spans the amino acid sequence from region 21-115. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor beta variable 16 TRBV16

UniProt

A0A087WV62

Expression Region

21-115

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

EEVAQTPKHLVRGEGQKAKLYCAPIKGHSYVFWYQQVLKNEFKFLISFQNENVFDETGMPKERFSAKCLPNSPCSLEIQATKLEDSAVYFCASSQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

13-Ethyl-3-Butanoyloxy-18,19-dinor-17alpha-pregna-3,5-dien-20-yn-17-Butanoyloxy
TRC-E319940-50MG 50 mg

13-Ethyl-3-Butanoyloxy-18,19-dinor-17alpha-pregna-3,5-dien-20-yn-17-Butanoyloxy

Sign In for Pricing
View Details
PLOD2 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI6D1]
TA803224AM 100 µL

PLOD2 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI6D1]

Sign In for Pricing
View Details
NPAS1 antibody
FNab05809 100 µg

NPAS1 antibody

Sign In for Pricing
View Details
Hprt Mouse Gene Knockout Kit (CRISPR)
KN307926BN 1 Kit

Hprt Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
2-Descyano-2-ethyl Formyl-tofacitinib
TRC-D221590-50MG 50 mg

2-Descyano-2-ethyl Formyl-tofacitinib

Sign In for Pricing
View Details
Recombinant CD45 Antibody
RC-3743-01 50 μL

Recombinant CD45 Antibody

Sign In for Pricing
View Details