Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor beta variable 16 (TVB16), Biotinylated

This Recombinant Human T cell receptor beta variable 16 (TVB16), Biotinylated spans the amino acid sequence from region 21-115. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor beta variable 16 TRBV16

UniProt

A0A087WV62

Expression Region

21-115

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

EEVAQTPKHLVRGEGQKAKLYCAPIKGHSYVFWYQQVLKNEFKFLISFQNENVFDETGMPKERFSAKCLPNSPCSLEIQATKLEDSAVYFCASSQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HEXIM2 Rabbit Polyclonal Antibody
TA366599 100 µL

HEXIM2 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
TGF-beta (1D11.16.8), CF640R conjugate, 0.1mg/mL
BNC400977-500 1x 500 µL

TGF-beta (1D11.16.8), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Porcine TG (Thyroglobulin) ELISA Kit
E-EL-P3002-01 24 Tests

Porcine TG (Thyroglobulin) ELISA Kit

Sign In for Pricing
View Details
Porcine TG (Thyroglobulin) ELISA Kit
E-EL-P3002-02 48 Tests

Porcine TG (Thyroglobulin) ELISA Kit

Sign In for Pricing
View Details
Porcine TG (Thyroglobulin) ELISA Kit
E-EL-P3002-03 96 Tests

Porcine TG (Thyroglobulin) ELISA Kit

Sign In for Pricing
View Details
CPT1A Human Gene Knockout Kit (CRISPR)
KN200485 1 Kit

CPT1A Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details