Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Probable non-functional T cell receptor beta variable 17 (TVB17), Biotinylated

This Recombinant Human Probable non-functional T cell receptor beta variable 17 (TVB17), Biotinylated spans the amino acid sequence from region 20-114. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Probable non-functional T cell receptor beta variable 17 TRBV17

UniProt

A0A087X0K7

Expression Region

20-114

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

EPGVSQTPRHKVTNMGQEVILRCDPSSGHMFVHWYRQNLRQEMKLLISFQYQNIAVDSGMPKERFTAERPNGTSSTLKIHPAEPRDSAVYLYSSG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human CEACAM1 Antibody Pair Set
E-KAB-0418 50 µL & 100 µg

Human CEACAM1 Antibody Pair Set

Sign In for Pricing
View Details
Human Complement Component 1, Q Subcomponent C (C1qC) ELISA Kit
RDR-C1qC-Hu-01 96 Tests

Human Complement Component 1, Q Subcomponent C (C1qC) ELISA Kit

Sign In for Pricing
View Details
Human Complement Component 1, Q Subcomponent C (C1qC) ELISA Kit
RDR-C1qC-Hu-02 48 Tests

Human Complement Component 1, Q Subcomponent C (C1qC) ELISA Kit

Sign In for Pricing
View Details
GATA5 Human Gene Knockout Kit (CRISPR)
KN418399 1 Kit

GATA5 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
LysoViewTM 680, 1000X in DMSO
#70086 1x 50 µL

LysoViewTM 680, 1000X in DMSO

Sign In for Pricing
View Details
TRIM38 antibody
FNab08983 100 µg

TRIM38 antibody

Sign In for Pricing
View Details