Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Probable non-functional T cell receptor beta variable 17 (TVB17), Biotinylated

This Recombinant Human Probable non-functional T cell receptor beta variable 17 (TVB17), Biotinylated spans the amino acid sequence from region 20-114. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Probable non-functional T cell receptor beta variable 17 TRBV17

UniProt

A0A087X0K7

Expression Region

20-114

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

EPGVSQTPRHKVTNMGQEVILRCDPSSGHMFVHWYRQNLRQEMKLLISFQYQNIAVDSGMPKERFTAERPNGTSSTLKIHPAEPRDSAVYLYSSG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ASB13 Protein Vector (Human) (pPM-N-D-C-His)
PV324185 500 ng

ASB13 Protein Vector (Human) (pPM-N-D-C-His)

Sign In for Pricing
View Details
Lamin B1 (G-1)
sc-373918 200 µg/mL

Lamin B1 (G-1)

Sign In for Pricing
View Details
Pyridoxal 5'-Phosphate-d3 (>85%)
TRC-H605892-5MG 5 mg

Pyridoxal 5'-Phosphate-d3 (>85%)

Sign In for Pricing
View Details
TSSK3 Protein-GST Fusion
B2024076 20 µg

TSSK3 Protein-GST Fusion

Sign In for Pricing
View Details
Human CCR7 Alexa Fluor 700 MAb (Clone 150503)
FAB197N-100 100 Tests

Human CCR7 Alexa Fluor 700 MAb (Clone 150503)

Sign In for Pricing
View Details
Anti-Ep-CAM / CD326 (Extracellular Domain) (Epithelial Marker) Monoclonal Antibody (Clone: EGP40/1798)
36-2721-100 100 µg

Anti-Ep-CAM / CD326 (Extracellular Domain) (Epithelial Marker) Monoclonal Antibody (Clone: EGP40/1798)

Sign In for Pricing
View Details