Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor beta variable 18 (TVB18), Biotinylated

This Recombinant Human T cell receptor beta variable 18 (TVB18), Biotinylated spans the amino acid sequence from region 22-115. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor beta variable 18 TRBV18

UniProt

A0A087X0M5

Expression Region

22-115

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

GVMQNPRHLVRRRGQEARLRCSPMKGHSHVYWYRQLPEEGLKFMVYLQKENIIDESGMPKERFSAEFPKEGPSILRIQQVVRGDSAAYFCASSP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Col18a1 activation kit by CRISPRa
GA200810 1 Kit

Mouse Col18a1 activation kit by CRISPRa

Sign In for Pricing
View Details
KHK Antibody
KC-595-01 50 μL

KHK Antibody

Sign In for Pricing
View Details
KHK Antibody
KC-595-02 100 µL

KHK Antibody

Sign In for Pricing
View Details
KHK Antibody
KC-595-03 1 mL

KHK Antibody

Sign In for Pricing
View Details
Bulk Anti-Human CD2 (G11) Antibody
ICH1001-25mg 25 mg

Bulk Anti-Human CD2 (G11) Antibody

Sign In for Pricing
View Details
Pure Ulex europaeus Lectin (GorseFurze) -UEA-I-
L-2201-2 2 mg

Pure Ulex europaeus Lectin (GorseFurze) -UEA-I-

Sign In for Pricing
View Details