Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Cytochrome b-c1 complex subunit 6-like, mitochondrial (QCR6L), Biotinylated

This Recombinant Human Cytochrome b-c1 complex subunit 6-like, mitochondrial (QCR6L), Biotinylated spans the amino acid sequence from region 14-91. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Cytochrome b-c1 complex subunit 6-like, mitochondrial UQCRHL

UniProt

A0A096LP55

Expression Region

14-91

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

GDPEEEEEEEEELVDPLTTVREQCEQLEKCVKARERLELYDEHVSSRSHTEEDCTEELFDFLHAKDHCVAHKLFNNLK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TRIP6 Recombinant Protein (Mouse)
RP181337 100 µg

TRIP6 Recombinant Protein (Mouse)

Sign In for Pricing
View Details
SIPA1L1 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)
43795111 3x 1.0 µg

SIPA1L1 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)

Sign In for Pricing
View Details
Anti-EIF1AY  (2B8)
YF-MA16649 100 ug

Anti-EIF1AY (2B8)

Sign In for Pricing
View Details
Lentiviral human ERH shRNA (UAS) - Lentiviral human ERH shRNA (UAS, RFP) plasmid
GTR15087169 1 Vial

Lentiviral human ERH shRNA (UAS) - Lentiviral human ERH shRNA (UAS, RFP) plasmid

Sign In for Pricing
View Details
DUSP10 Rabbit Polyclonal Antibody
TA349312 100 µL

DUSP10 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Goat Histone-H2B ELISA Kit
MBS014424 Inquire

Goat Histone-H2B ELISA Kit

Sign In for Pricing
View Details