Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Immunoglobulin kappa variable 2D-26 (KVD26), Biotinylated

This Recombinant Human Immunoglobulin kappa variable 2D-26 (KVD26), Biotinylated spans the amino acid sequence from region 21-120. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Immunoglobulin kappa variable 2D-26 IGKV2D-26

UniProt

A0A0A0MRZ7

Expression Region

21-120

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

EIVMTQTPLSLSITPGEQASMSCRSSQSLLHSDGYTYLYWFLQKARPVSTLLIYEVSNRFSGVPDRFSGSGSGTDFTLKISRVEAEDFGVYYCMQDAQDP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Hydroxy-PEG5-acid
T39483 10 mg

Hydroxy-PEG5-acid

Sign In for Pricing
View Details
Nori® Chicken Cyclophilin B (CyPB) ELISA Kit
GR114032 96 Well

Nori® Chicken Cyclophilin B (CyPB) ELISA Kit

Sign In for Pricing
View Details
Anti-Hu CD172a PerCP-Cy™5.5
T9-798-T100 100 Tests

Anti-Hu CD172a PerCP-Cy™5.5

Sign In for Pricing
View Details
IRS2 Rabbit Polyclonal Antibody (Fluoro594)
orb3116753 100 µg

IRS2 Rabbit Polyclonal Antibody (Fluoro594)

Sign In for Pricing
View Details
Rabbit Polyclonal RBP7 Antibody
NBP2-85613-0.1mL 0.1 mL

Rabbit Polyclonal RBP7 Antibody

Sign In for Pricing
View Details
TBC1D4 sgRNA CRISPR Lentivector set (Human)
K2339201 3x 1.0 µg

TBC1D4 sgRNA CRISPR Lentivector set (Human)

Sign In for Pricing
View Details