Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Immunoglobulin kappa variable 3D-11 (KVD11), Biotinylated

This Recombinant Human Immunoglobulin kappa variable 3D-11 (KVD11), Biotinylated spans the amino acid sequence from region 21-115. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Immunoglobulin kappa variable 3D-11 IGKV3D-11

UniProt

A0A0A0MRZ8

Expression Region

21-115

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

EIVLTQSPATLSLSPGERATLSCRASQSVSSYLAWYQQKPGQAPRLLIYDASNRATGIPARFSGSGPGTDFTLTISSLEPEDFAVYYCQQRSNWH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Vmn1r202 Mouse qPCR Primer Pair (NM_134224)
MP218372 200 Reactions

Vmn1r202 Mouse qPCR Primer Pair (NM_134224)

Sign In for Pricing
View Details
Mouse Fxyd4 ELISA KIT
ELI-13160m 96 Tests

Mouse Fxyd4 ELISA KIT

Sign In for Pricing
View Details
GG6L2 rabbit pAb Antibody
orb2305146-01 50 µL

GG6L2 rabbit pAb Antibody

Sign In for Pricing
View Details
GG6L2 rabbit pAb Antibody
orb2305146-02 100 µL

GG6L2 rabbit pAb Antibody

Sign In for Pricing
View Details
ARL2BP Antibody
orb670575-01 50 µg

ARL2BP Antibody

Sign In for Pricing
View Details
ARL2BP Antibody
orb670575-02 100 µg

ARL2BP Antibody

Sign In for Pricing
View Details