Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Probable non-functional immunoglobulin lambda variable 3-32 (LV332), Biotinylated

This Recombinant Human Probable non-functional immunoglobulin lambda variable 3-32 (LV332), Biotinylated spans the amino acid sequence from region 20-114. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Probable non-functional immunoglobulin lambda variable 3-32 IGLV3-32

UniProt

A0A0A0MS00

Expression Region

20-114

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

SGPTQVPAVSVALGQMARITCQGDSMEGSYEHWYQQKPGQAPVLVIYDSSDRPSRIPERFSGSKSGNTTTLTITGAQAEDEADYYYQLIDNHATQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Canine Toll Like Receptor 3 ELISA Kit
MBS011820-01 48 Well

Canine Toll Like Receptor 3 ELISA Kit

Sign In for Pricing
View Details
Canine Toll Like Receptor 3 ELISA Kit
MBS011820-02 96 Well

Canine Toll Like Receptor 3 ELISA Kit

Sign In for Pricing
View Details
Canine Toll Like Receptor 3 ELISA Kit
MBS011820-03 5x 96 Well

Canine Toll Like Receptor 3 ELISA Kit

Sign In for Pricing
View Details
Canine Toll Like Receptor 3 ELISA Kit
MBS011820-04 10x 96 Well

Canine Toll Like Receptor 3 ELISA Kit

Sign In for Pricing
View Details
Lentiviral human NDRG1 sgRNA gene knockout kit - Lentiviral human NDRG1 sgRNA gene knockout kit (plasmid)
GTR15366851 1 Vial

Lentiviral human NDRG1 sgRNA gene knockout kit - Lentiviral human NDRG1 sgRNA gene knockout kit (plasmid)

Sign In for Pricing
View Details
FK506 Binding Protein 14 Human Recombinant (FKBP14 Human)
PT_40590-01 5 µg

FK506 Binding Protein 14 Human Recombinant (FKBP14 Human)

Sign In for Pricing
View Details