Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Probable non-functional immunoglobulin lambda variable 3-32 (LV332), Biotinylated

This Recombinant Human Probable non-functional immunoglobulin lambda variable 3-32 (LV332), Biotinylated spans the amino acid sequence from region 20-114. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Probable non-functional immunoglobulin lambda variable 3-32 IGLV3-32

UniProt

A0A0A0MS00

Expression Region

20-114

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

SGPTQVPAVSVALGQMARITCQGDSMEGSYEHWYQQKPGQAPVLVIYDSSDRPSRIPERFSGSKSGNTTTLTITGAQAEDEADYYYQLIDNHATQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

DNA-PKCS (phospho Ser2612) Polyclonal Antibody
orb1414914 100 µL

DNA-PKCS (phospho Ser2612) Polyclonal Antibody

Sign In for Pricing
View Details
Protein DEK, Recombinant, Human, aa309-375, His-Tag, Myc-Tag
585953-01 20 µg

Protein DEK, Recombinant, Human, aa309-375, His-Tag, Myc-Tag

Sign In for Pricing
View Details
Protein DEK, Recombinant, Human, aa309-375, His-Tag, Myc-Tag
585953-02 100 µg

Protein DEK, Recombinant, Human, aa309-375, His-Tag, Myc-Tag

Sign In for Pricing
View Details
C2CD2L siRNA (Human)
CRH6604-01 15 nmol

C2CD2L siRNA (Human)

Sign In for Pricing
View Details
C2CD2L siRNA (Human)
CRH6604-02 30 nmol

C2CD2L siRNA (Human)

Sign In for Pricing
View Details
PM-81I
orb1982756-01 25 mg

PM-81I

Sign In for Pricing
View Details