Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Probable non-functional T cell receptor beta variable 5-3 (TVB53), Biotinylated

This Recombinant Human Probable non-functional T cell receptor beta variable 5-3 (TVB53), Biotinylated spans the amino acid sequence from region 22-114. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Probable non-functional T cell receptor beta variable 5-3 TRBV5-3

UniProt

A0A0A0MS03

Expression Region

22-114

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

GVTQSPTHLIKTRGQQVTLRCSPISGHSSVSWYQQAPGQGPQFIFEYANELRRSEGNFPNRFSGRQFHDYCSEMNVSALELGDSALYLCARSL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CF®488A-Dextran 40,000 MW, Anionic and Fixable
#80126 1x 1 mg

CF®488A-Dextran 40,000 MW, Anionic and Fixable

Sign In for Pricing
View Details
Pex5 Mouse Gene Knockout Kit (CRISPR)
KN313129BN 1 Kit

Pex5 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Cibacron Brilliant Yellow 3G-P, Technical Grade
TRC-C535733-5G 5 g

Cibacron Brilliant Yellow 3G-P, Technical Grade

Sign In for Pricing
View Details
CCS Machine (Manual sampling) BPTL-109
BPTL-109 1 Unit

CCS Machine (Manual sampling) BPTL-109

Sign In for Pricing
View Details
CD106 / VCAM1 (1.4C3), CF740 conjugate, 0.1mg/mL
BNC740149-500 1x 500 µL

CD106 / VCAM1 (1.4C3), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
LINC02915 Human Gene Knockout Kit (CRISPR)
KN422975 1 Kit

LINC02915 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details