Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Probable non-functional T cell receptor beta variable 5-3 (TVB53), Biotinylated

This Recombinant Human Probable non-functional T cell receptor beta variable 5-3 (TVB53), Biotinylated spans the amino acid sequence from region 22-114. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Probable non-functional T cell receptor beta variable 5-3 TRBV5-3

UniProt

A0A0A0MS03

Expression Region

22-114

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

GVTQSPTHLIKTRGQQVTLRCSPISGHSSVSWYQQAPGQGPQFIFEYANELRRSEGNFPNRFSGRQFHDYCSEMNVSALELGDSALYLCARSL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human AQP-3 protein (GST tag)
PDEH100837-01 20 µg

Recombinant Human AQP-3 protein (GST tag)

Sign In for Pricing
View Details
Recombinant Human AQP-3 protein (GST tag)
PDEH100837-02 100 µg

Recombinant Human AQP-3 protein (GST tag)

Sign In for Pricing
View Details
Recombinant Human AQP-3 protein (GST tag)
PDEH100837-03 500 µg

Recombinant Human AQP-3 protein (GST tag)

Sign In for Pricing
View Details
Recombinant Human AQP-3 protein (GST tag)
PDEH100837-04 1 mg

Recombinant Human AQP-3 protein (GST tag)

Sign In for Pricing
View Details
PROX1 (723-727) Rabbit Polyclonal Antibody
AP26049PU-N 100 µL

PROX1 (723-727) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Water Bath BBWA-3202
BBWA-3202 1 Unit

Water Bath BBWA-3202

Sign In for Pricing
View Details