Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Probable non-functional T cell receptor beta variable 23-1 (TVB23), Biotinylated

This Recombinant Human Probable non-functional T cell receptor beta variable 23-1 (TVB23), Biotinylated spans the amino acid sequence from region 22-115. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Probable non-functional T cell receptor beta variable 23-1 TRBV23-1

UniProt

A0A0A0MS06

Expression Region

22-115

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

KVTQTPGHLVKGKGQKTKMDCTPEKGHTFVYWYQQNQNKEFMLLISFQNEQVLQETEMHKKRFSSQCPKNAPCSLAILSSEPGDTALYLCASSQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Bag3 Recombinant Rabbit Monoclonal Antibody [JA90-53]
ET1704-73 100 µL

Bag3 Recombinant Rabbit Monoclonal Antibody [JA90-53]

Sign In for Pricing
View Details
Upk3a Mouse Gene Knockout Kit (CRISPR)
KN518729 1 Kit

Upk3a Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Brilliant Calcium Gold Flex
10020-10 10 Plates

Brilliant Calcium Gold Flex

Sign In for Pricing
View Details
Tmem74 Mouse Gene Knockout Kit (CRISPR)
KN517898 1 Kit

Tmem74 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Mouse Linker For Activation Of T-Cell (LAT) ELISA Kit
RD-LAT-Mu-01 96 Tests

Mouse Linker For Activation Of T-Cell (LAT) ELISA Kit

Sign In for Pricing
View Details
Mouse Linker For Activation Of T-Cell (LAT) ELISA Kit
RD-LAT-Mu-02 48 Tests

Mouse Linker For Activation Of T-Cell (LAT) ELISA Kit

Sign In for Pricing
View Details