Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Probable non-functional T cell receptor beta variable 23-1 (TVB23), Biotinylated

This Recombinant Human Probable non-functional T cell receptor beta variable 23-1 (TVB23), Biotinylated spans the amino acid sequence from region 22-115. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Probable non-functional T cell receptor beta variable 23-1 TRBV23-1

UniProt

A0A0A0MS06

Expression Region

22-115

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

KVTQTPGHLVKGKGQKTKMDCTPEKGHTFVYWYQQNQNKEFMLLISFQNEQVLQETEMHKKRFSSQCPKNAPCSLAILSSEPGDTALYLCASSQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Iso Imperatorin
TRC-I820150-10MG 10 mg

Iso Imperatorin

Sign In for Pricing
View Details
CD106 / VCAM1 (1.4C3), 0.2mg/mL
BNUB0149-100 1x 100 µL

CD106 / VCAM1 (1.4C3), 0.2mg/mL

Sign In for Pricing
View Details
Human PALMD activation kit by CRISPRa
GA110330 1 Kit

Human PALMD activation kit by CRISPRa

Sign In for Pricing
View Details
Human Tankyrase 2 (TNKS2) ELISA Kit
RD-TNKS2-Hu-01 96 Tests

Human Tankyrase 2 (TNKS2) ELISA Kit

Sign In for Pricing
View Details
Human Tankyrase 2 (TNKS2) ELISA Kit
RD-TNKS2-Hu-02 48 Tests

Human Tankyrase 2 (TNKS2) ELISA Kit

Sign In for Pricing
View Details
CD1c (CD1C/1603), Biotin conjugate, 0.1mg/mL
BNCB1603-100 1x 100 µL

CD1c (CD1C/1603), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details