Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Immunoglobulin heavy variable 1-45 (HV145), Biotinylated

This Recombinant Human Immunoglobulin heavy variable 1-45 (HV145), Biotinylated spans the amino acid sequence from region 20-117. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Immunoglobulin heavy variable 1-45 IGHV1-45

UniProt

A0A0A0MS14

Expression Region

20-117

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

QMQLVQSGAEVKKTGSSVKVSCKASGYTFTYRYLHWVRQAPGQALEWMGWITPFNGNTNYAQKFQDRVTITRDRSMSTAYMELSSLRSEDTAMYYCAR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human C-C Motif Chemokine 23/CCL23
32-7076-50 50 µg

Recombinant Human C-C Motif Chemokine 23/CCL23

Sign In for Pricing
View Details
RGS2 antibody
MBS9400862-01 0.05 mL

RGS2 antibody

Sign In for Pricing
View Details
RGS2 antibody
MBS9400862-02 0.1 mL

RGS2 antibody

Sign In for Pricing
View Details
RGS2 antibody
MBS9400862-03 5x 0.1 mL

RGS2 antibody

Sign In for Pricing
View Details
Mouse Urgcp Pre-designed siRNA Set B
SI115736B 1 Each

Mouse Urgcp Pre-designed siRNA Set B

Sign In for Pricing
View Details
CTIP2/BCL11B Rabbit pAb (APR29032N)
APR29032N-01 50 µL

CTIP2/BCL11B Rabbit pAb (APR29032N)

Sign In for Pricing
View Details