Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Immunoglobulin heavy variable 1-45 (HV145), Biotinylated

This Recombinant Human Immunoglobulin heavy variable 1-45 (HV145), Biotinylated spans the amino acid sequence from region 20-117. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Immunoglobulin heavy variable 1-45 IGHV1-45

UniProt

A0A0A0MS14

Expression Region

20-117

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

QMQLVQSGAEVKKTGSSVKVSCKASGYTFTYRYLHWVRQAPGQALEWMGWITPFNGNTNYAQKFQDRVTITRDRSMSTAYMELSSLRSEDTAMYYCAR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Collagen Type VIII Alpha 1 ELISA Kit
MBS730479-01 48 Well

Rabbit Collagen Type VIII Alpha 1 ELISA Kit

Sign In for Pricing
View Details
Rabbit Collagen Type VIII Alpha 1 ELISA Kit
MBS730479-02 96 Well

Rabbit Collagen Type VIII Alpha 1 ELISA Kit

Sign In for Pricing
View Details
Rabbit Collagen Type VIII Alpha 1 ELISA Kit
MBS730479-03 5x 96 Well

Rabbit Collagen Type VIII Alpha 1 ELISA Kit

Sign In for Pricing
View Details
Rabbit Collagen Type VIII Alpha 1 ELISA Kit
MBS730479-04 10x 96 Well

Rabbit Collagen Type VIII Alpha 1 ELISA Kit

Sign In for Pricing
View Details
Anti-p70 S6 Kinase 1 (Rabbit, Polyclonal)
A105231 100 µL

Anti-p70 S6 Kinase 1 (Rabbit, Polyclonal)

Sign In for Pricing
View Details
NEDD9 (Neural Precursor Cell Expressed Developmentally Down-regulated protein 9, Enhancer of Filamentation 1, hEF1, CRK-associated Substrate-related Protein, CAS-L, CasL, Cas Scaffolding Protein Family Member 2, NEDD-9, Renal Carcinoma Antigen NY-REN-12, p105, CASL, CASS2) (MaxLight 405) discontinued
130261-ML405 100 µL

NEDD9 (Neural Precursor Cell Expressed Developmentally Down-regulated protein 9, Enhancer of Filamentation 1, hEF1, CRK-associated Substrate-related Protein, CAS-L, CasL, Cas Scaffolding Protein Family Member 2, NEDD-9, Renal Carcinoma Antigen NY-REN-12, p105, CASL, CASS2) (MaxLight 405) discontinued

Sign In for Pricing
View Details