Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Immunoglobulin heavy variable 1-45 (HV145), Biotinylated

This Recombinant Human Immunoglobulin heavy variable 1-45 (HV145), Biotinylated spans the amino acid sequence from region 20-117. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Immunoglobulin heavy variable 1-45 IGHV1-45

UniProt

A0A0A0MS14

Expression Region

20-117

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

QMQLVQSGAEVKKTGSSVKVSCKASGYTFTYRYLHWVRQAPGQALEWMGWITPFNGNTNYAQKFQDRVTITRDRSMSTAYMELSSLRSEDTAMYYCAR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Angiopoietin-2 / ANGPT2 Protein, His Tag
AN2-M52H3-100ug 100 µg

Mouse Angiopoietin-2 / ANGPT2 Protein, His Tag

Sign In for Pricing
View Details
Monoclonal Antibody to Interleukin 6 (IL6)
TRV-0032651-01 20 µL

Monoclonal Antibody to Interleukin 6 (IL6)

Sign In for Pricing
View Details
Monoclonal Antibody to Interleukin 6 (IL6)
TRV-0032651-02 100 µL

Monoclonal Antibody to Interleukin 6 (IL6)

Sign In for Pricing
View Details
Monoclonal Antibody to Interleukin 6 (IL6)
TRV-0032651-03 200 µL

Monoclonal Antibody to Interleukin 6 (IL6)

Sign In for Pricing
View Details
Monoclonal Antibody to Interleukin 6 (IL6)
TRV-0032651-04 1 mL

Monoclonal Antibody to Interleukin 6 (IL6)

Sign In for Pricing
View Details
RPA3 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 3)
K1871308 1.0 µg DNA

RPA3 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 3)

Sign In for Pricing
View Details