Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Immunoglobulin heavy variable 3-49 (HV349), Biotinylated

This Recombinant Human Immunoglobulin heavy variable 3-49 (HV349), Biotinylated spans the amino acid sequence from region 20-119. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Immunoglobulin heavy variable 3-49 IGHV3-49

UniProt

A0A0A0MS15

Expression Region

20-119

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

EVQLVESGGGLVQPGRSLRLSCTASGFTFGDYAMSWVRQAPGKGLEWVGFIRSKAYGGTTEYAASVKGRFTISRDDSKSIAYLQMNSLKTEDTAVYYCTR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Frozen Tissue Sections, Kidney
CS639372 5x 5 µm

Frozen Tissue Sections, Kidney

Sign In for Pricing
View Details
C10orf7 (CDC123) Rabbit Polyclonal Antibody
TA372130 100 µL

C10orf7 (CDC123) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
IRF3 (Ab-396) Antibody
8B0667-AAT 50 µg

IRF3 (Ab-396) Antibody

Sign In for Pricing
View Details
RAGE (AGER) (NM_001136) Human Recombinant Protein
TP720357L 500 µg

RAGE (AGER) (NM_001136) Human Recombinant Protein

Sign In for Pricing
View Details
DERL1 (NM_001134671) Human Over-expression Lysate
LC427475 20 µg

DERL1 (NM_001134671) Human Over-expression Lysate

Sign In for Pricing
View Details
FAP Polyclonal Antibody
E-AB-11218-01 20 µL

FAP Polyclonal Antibody

Sign In for Pricing
View Details