Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor alpha variable 14/delta variable 4 (TVA14), Biotinylated

This Recombinant Human T cell receptor alpha variable 14/delta variable 4 (TVA14), Biotinylated spans the amino acid sequence from region 22-116. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor alpha variable 14/delta variable 4 TRAV14DV4

UniProt

A0A0A6YYC5

Expression Region

22-116

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

QKITQTQPGMFVQEKEAVTLDCTYDTSDPSYGLFWYKQPSSGEMIFLIYQGSYDQQNATEGRYSLNFQKARKSANLVISASQLGDSAMYFCAMRE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Adck5 Rat shRNA Plasmid (Locus ID 362943)
TR708994 1 Kit

Adck5 Rat shRNA Plasmid (Locus ID 362943)

Sign In for Pricing
View Details
Recombinant Human CD77/A4GALT Protein, N-His
orb3059821-01 50 µg

Recombinant Human CD77/A4GALT Protein, N-His

Sign In for Pricing
View Details
Recombinant Human CD77/A4GALT Protein, N-His
orb3059821-02 100 µg

Recombinant Human CD77/A4GALT Protein, N-His

Sign In for Pricing
View Details
Recombinant Human CD77/A4GALT Protein, N-His
orb3059821-03 1 mg

Recombinant Human CD77/A4GALT Protein, N-His

Sign In for Pricing
View Details
RPS20P29 sgRNA CRISPR Lentivector (Human) (Target 3)
K2042804 1.0 µg DNA

RPS20P29 sgRNA CRISPR Lentivector (Human) (Target 3)

Sign In for Pricing
View Details
hsa-miR-103-as miRNA Antagomir
MNH01036 2x 5.0 nmol

hsa-miR-103-as miRNA Antagomir

Sign In for Pricing
View Details