Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor beta variable 13 (TVB13), Biotinylated

This Recombinant Human T cell receptor beta variable 13 (TVB13), Biotinylated spans the amino acid sequence from region 32-124. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor beta variable 13 TRBV13

UniProt

A0A0A6YYD4

Expression Region

32-124

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

GVIQSPRHLIKEKRETATLKCYPIPRHDTVYWYQQGPGQDPQFLISFYEKMQSDKGSIPDRFSAQQFSDYHSELNMSSLELGDSALYFCASSL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Mouse APOA1BP Protein, His (Fc)-Avi-tagged
APOA1BP-626M 50 µg

Recombinant Mouse APOA1BP Protein, His (Fc)-Avi-tagged

Sign In for Pricing
View Details
CMTM1 (CKLF-like MARVEL Transmembrane Domain-containing Protein 1, Chemokine-like Factor Superfamily Member 1, CMTM1, CKLFSF1) discontinued
342584-01 100 µL

CMTM1 (CKLF-like MARVEL Transmembrane Domain-containing Protein 1, Chemokine-like Factor Superfamily Member 1, CMTM1, CKLFSF1) discontinued

Sign In for Pricing
View Details
CMTM1 (CKLF-like MARVEL Transmembrane Domain-containing Protein 1, Chemokine-like Factor Superfamily Member 1, CMTM1, CKLFSF1) discontinued
342584-02 200 µL

CMTM1 (CKLF-like MARVEL Transmembrane Domain-containing Protein 1, Chemokine-like Factor Superfamily Member 1, CMTM1, CKLFSF1) discontinued

Sign In for Pricing
View Details
ACOXL (NM_001142807) Human Recombinant Protein
TP761031 50 µg

ACOXL (NM_001142807) Human Recombinant Protein

Sign In for Pricing
View Details
Rrn3 siRNA Oligos set (Rat)
42748176 3x 5 nmol

Rrn3 siRNA Oligos set (Rat)

Sign In for Pricing
View Details
Fluorouracil (Adrucil) 10mM * 1mL in DMSO
A10042-10mM-D 10 mM x 1mL in DMSO

Fluorouracil (Adrucil) 10mM * 1mL in DMSO

Sign In for Pricing
View Details