Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor beta variable 6-6 (TVB66), Biotinylated

This Recombinant Human T cell receptor beta variable 6-6 (TVB66), Biotinylated spans the amino acid sequence from region 22-114. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor beta variable 6-6 TRBV6-6

UniProt

A0A0A6YYG2

Expression Region

22-114

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

GVTQTPKFRILKIGQSMTLQCAQDMNHNYMYWYRQDPGMGLKLIYYSVGAGITDKGEVPNGYNVSRSTTEDFPLRLELAAPSQTSVYFCASSY

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Monoclonal KChIP2 Antibody (KCNIP2/7589) [Alexa Fluor 700]
NBP3-24039AF700 0.1 mL

Mouse Monoclonal KChIP2 Antibody (KCNIP2/7589) [Alexa Fluor 700]

Sign In for Pricing
View Details
Phosphate Buffered Saline (PBS, pH 7.4) concentrate (20X)
80081 100 mL

Phosphate Buffered Saline (PBS, pH 7.4) concentrate (20X)

Sign In for Pricing
View Details
Recombinant Human Sideroflexin-4 (SFXN4)
MBS7029683-01 0.02 mg

Recombinant Human Sideroflexin-4 (SFXN4)

Sign In for Pricing
View Details
Recombinant Human Sideroflexin-4 (SFXN4)
MBS7029683-02 0.1 mg

Recombinant Human Sideroflexin-4 (SFXN4)

Sign In for Pricing
View Details
Recombinant Human Sideroflexin-4 (SFXN4)
MBS7029683-03 5x 0.1 mg

Recombinant Human Sideroflexin-4 (SFXN4)

Sign In for Pricing
View Details
Monosialoganglioside GM2 (Human)
MBS393581-01 0.5 mg

Monosialoganglioside GM2 (Human)

Sign In for Pricing
View Details