Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor beta variable 6-6 (TVB66), Biotinylated

This Recombinant Human T cell receptor beta variable 6-6 (TVB66), Biotinylated spans the amino acid sequence from region 22-114. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor beta variable 6-6 TRBV6-6

UniProt

A0A0A6YYG2

Expression Region

22-114

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

GVTQTPKFRILKIGQSMTLQCAQDMNHNYMYWYRQDPGMGLKLIYYSVGAGITDKGEVPNGYNVSRSTTEDFPLRLELAAPSQTSVYFCASSY

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Monoclonal IL-17RA/IL-17R Antibody (brodalumab) [Janelia Fluor 525]
NBP3-27988JF525 0.1 mL

Human Monoclonal IL-17RA/IL-17R Antibody (brodalumab) [Janelia Fluor 525]

Sign In for Pricing
View Details
Anti-NHERF-2/SIP-1/SLC9A3R2 Antibody Picoband®, Cy3 Conjugate
A05624-2-Cy3 100 µg/Vial

Anti-NHERF-2/SIP-1/SLC9A3R2 Antibody Picoband®, Cy3 Conjugate

Sign In for Pricing
View Details
Human DIRAS2 (NM_017594) AAV Particle
RC200740A1V 250 µL

Human DIRAS2 (NM_017594) AAV Particle

Sign In for Pricing
View Details
IDUA Peptide - N-terminal region
orb2002308 100 µg

IDUA Peptide - N-terminal region

Sign In for Pricing
View Details
Ar sgRNA CRISPR/Cas9 All-in-One Lentivector set (Rat)
12233116 3x 1.0 µg

Ar sgRNA CRISPR/Cas9 All-in-One Lentivector set (Rat)

Sign In for Pricing
View Details
CMTX3 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 3)
K0473508 1.0 µg DNA

CMTX3 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 3)

Sign In for Pricing
View Details