Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor beta variable 6-6 (TVB66), Biotinylated

This Recombinant Human T cell receptor beta variable 6-6 (TVB66), Biotinylated spans the amino acid sequence from region 22-114. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor beta variable 6-6 TRBV6-6

UniProt

A0A0A6YYG2

Expression Region

22-114

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

GVTQTPKFRILKIGQSMTLQCAQDMNHNYMYWYRQDPGMGLKLIYYSVGAGITDKGEVPNGYNVSRSTTEDFPLRLELAAPSQTSVYFCASSY

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Staphylococcus aureus Clumping factor A(clfA), partial
AP74075-01 20 µg

Recombinant Staphylococcus aureus Clumping factor A(clfA), partial

Sign In for Pricing
View Details
Recombinant Staphylococcus aureus Clumping factor A(clfA), partial
AP74075-02 100 µg

Recombinant Staphylococcus aureus Clumping factor A(clfA), partial

Sign In for Pricing
View Details
Recombinant Staphylococcus aureus Clumping factor A(clfA), partial
AP74075-03 1 mg

Recombinant Staphylococcus aureus Clumping factor A(clfA), partial

Sign In for Pricing
View Details
Rabbit Polyclonal NFXL1 Antibody
NBP2-31746-25ul 25 µL

Rabbit Polyclonal NFXL1 Antibody

Sign In for Pricing
View Details
Bcl-XL (FITC)
B0807-15F 100 µg

Bcl-XL (FITC)

Sign In for Pricing
View Details
RRx-001
BA2046-10 10 mg

RRx-001

Sign In for Pricing
View Details