Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor alpha variable 8-3 (TVA83), Biotinylated

This Recombinant Human T cell receptor alpha variable 8-3 (TVA83), Biotinylated spans the amino acid sequence from region 21-113. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor alpha variable 8-3 TRAV8-3

UniProt

A0A0A6YYJ7

Expression Region

21-113

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

QSVTQPDIHITVSEGASLELRCNYSYGATPYLFWYVQSPGQGLQLLLKYFSGDTLVQGIKGFEAEFKRSQSSFNLRKPSVHWSDAAEYFCAVG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rb Rabbit Polyclonal Antibody
ES7006-01 50 µL

Rb Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Rb Rabbit Polyclonal Antibody
ES7006-02 100 µL

Rb Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
LOC499407 Lentiviral Vector (Rat) (UbC) (pLenti-GIII-UbC)
LV643409 1.0 µg DNA

LOC499407 Lentiviral Vector (Rat) (UbC) (pLenti-GIII-UbC)

Sign In for Pricing
View Details
SLC6A14 shRNA Plasmid (m)
sc-153573-SH 20 µg

SLC6A14 shRNA Plasmid (m)

Sign In for Pricing
View Details
Recombinant Mycobacterium bovis Phosphate import ATP-binding protein PstB 2 (pstB2)
MBS1483641-01 0.02 mg (E-Coli)

Recombinant Mycobacterium bovis Phosphate import ATP-binding protein PstB 2 (pstB2)

Sign In for Pricing
View Details
Recombinant Mycobacterium bovis Phosphate import ATP-binding protein PstB 2 (pstB2)
MBS1483641-02 0.02 mg (Yeast)

Recombinant Mycobacterium bovis Phosphate import ATP-binding protein PstB 2 (pstB2)

Sign In for Pricing
View Details