Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor alpha variable 8-1 (TVA81), Biotinylated

This Recombinant Human T cell receptor alpha variable 8-1 (TVA81), Biotinylated spans the amino acid sequence from region 21-113. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor alpha variable 8-1 TRAV8-1

UniProt

A0A0A6YYK1

Expression Region

21-113

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

QSVSQHNHHVILSEAASLELGCNYSYGGTVNLFWYVQYPGQHLQLLLKYFSGDPLVKGIKGFEAEFIKSKFSFNLRKPSVQWSDTAEYFCAVN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CABYRP1 Lentiviral Vector (Human) (UbC) (pLenti-GIII-UbC)
LV758379 1.0 µg DNA

CABYRP1 Lentiviral Vector (Human) (UbC) (pLenti-GIII-UbC)

Sign In for Pricing
View Details
IFI27 Polyclonal Antibody, APC Conjugated
bs-15549R-APC 100 µL

IFI27 Polyclonal Antibody, APC Conjugated

Sign In for Pricing
View Details
Mono-3-hydroxyisobutyl phthalate-d4
sc-484548 5 mg

Mono-3-hydroxyisobutyl phthalate-d4

Sign In for Pricing
View Details
Human Perforin/Pore-Forming Protein (PF/PFP) ELISA Kit
MBS9912007-01 48 Well

Human Perforin/Pore-Forming Protein (PF/PFP) ELISA Kit

Sign In for Pricing
View Details
Human Perforin/Pore-Forming Protein (PF/PFP) ELISA Kit
MBS9912007-02 96 Well

Human Perforin/Pore-Forming Protein (PF/PFP) ELISA Kit

Sign In for Pricing
View Details
Human Perforin/Pore-Forming Protein (PF/PFP) ELISA Kit
MBS9912007-03 5x 96 Well

Human Perforin/Pore-Forming Protein (PF/PFP) ELISA Kit

Sign In for Pricing
View Details