Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor alpha variable 8-1 (TVA81), Biotinylated

This Recombinant Human T cell receptor alpha variable 8-1 (TVA81), Biotinylated spans the amino acid sequence from region 21-113. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor alpha variable 8-1 TRAV8-1

UniProt

A0A0A6YYK1

Expression Region

21-113

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

QSVSQHNHHVILSEAASLELGCNYSYGGTVNLFWYVQYPGQHLQLLLKYFSGDPLVKGIKGFEAEFIKSKFSFNLRKPSVQWSDTAEYFCAVN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TRXRD2/SELZ Recombinant Antibody, RBITC Conjugated
bsm-62166R-RBITC 100 µL

TRXRD2/SELZ Recombinant Antibody, RBITC Conjugated

Sign In for Pricing
View Details
Recombinant Cebus apella Duffy antigen/chemokine receptor (DARC)
MBS7013642-01 0.02 mg

Recombinant Cebus apella Duffy antigen/chemokine receptor (DARC)

Sign In for Pricing
View Details
Recombinant Cebus apella Duffy antigen/chemokine receptor (DARC)
MBS7013642-02 0.1 mg

Recombinant Cebus apella Duffy antigen/chemokine receptor (DARC)

Sign In for Pricing
View Details
Recombinant Cebus apella Duffy antigen/chemokine receptor (DARC)
MBS7013642-03 5x 0.1 mg

Recombinant Cebus apella Duffy antigen/chemokine receptor (DARC)

Sign In for Pricing
View Details
Lcp1 sgRNA CRISPR Lentivector (Mouse) (Target 3)
K3725704 1.0 µg DNA

Lcp1 sgRNA CRISPR Lentivector (Mouse) (Target 3)

Sign In for Pricing
View Details
Iron (Fe) 1000 ppm Single Element Std. Soln. for ICP in HCl Nist Traceable
850070-01 100 mL

Iron (Fe) 1000 ppm Single Element Std. Soln. for ICP in HCl Nist Traceable

Sign In for Pricing
View Details