Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor alpha variable 8-1 (TVA81), Biotinylated

This Recombinant Human T cell receptor alpha variable 8-1 (TVA81), Biotinylated spans the amino acid sequence from region 21-113. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor alpha variable 8-1 TRAV8-1

UniProt

A0A0A6YYK1

Expression Region

21-113

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

QSVSQHNHHVILSEAASLELGCNYSYGGTVNLFWYVQYPGQHLQLLLKYFSGDPLVKGIKGFEAEFIKSKFSFNLRKPSVQWSDTAEYFCAVN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Polyclonal CHCHD5 Antibody [DyLight 650]
NBP3-05899C 0.1 mL

Rabbit Polyclonal CHCHD5 Antibody [DyLight 650]

Sign In for Pricing
View Details
Mouse Tektip1 Pre-designed siRNA Set B
SI114433B 1 Each

Mouse Tektip1 Pre-designed siRNA Set B

Sign In for Pricing
View Details
SSFA2 Antibody, Biotin conjugated
MBS1496728-01 0.05 mg

SSFA2 Antibody, Biotin conjugated

Sign In for Pricing
View Details
SSFA2 Antibody, Biotin conjugated
MBS1496728-02 0.1 mg

SSFA2 Antibody, Biotin conjugated

Sign In for Pricing
View Details
SSFA2 Antibody, Biotin conjugated
MBS1496728-03 5x 0.1 mg

SSFA2 Antibody, Biotin conjugated

Sign In for Pricing
View Details
Htr1a Rat shRNA Plasmid (Locus ID 24473)
TL709229 1 Kit

Htr1a Rat shRNA Plasmid (Locus ID 24473)

Sign In for Pricing
View Details