Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor alpha variable 19 (TVA19), Biotinylated

This Recombinant Human T cell receptor alpha variable 19 (TVA19), Biotinylated spans the amino acid sequence from region 22-116. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor alpha variable 19; T-cell receptor alpha chain V region HPB-MLT; TRAV19

UniProt

A0A0A6YYK7

Expression Region

22-116

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

QKVTQAQTEISVVEKEDVTLDCVYETRDTTYYLFWYKQPPSGELVFLIRRNSFDEQNEISGRYSWNFQKSTSSFNFTITASQVVDSAVYFCALSE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Hamster Beta-Crosslaps ELISA Kit
MBS107876-01 48 Well

Hamster Beta-Crosslaps ELISA Kit

Sign In for Pricing
View Details
Hamster Beta-Crosslaps ELISA Kit
MBS107876-02 96 Well

Hamster Beta-Crosslaps ELISA Kit

Sign In for Pricing
View Details
Hamster Beta-Crosslaps ELISA Kit
MBS107876-03 5x 96 Well

Hamster Beta-Crosslaps ELISA Kit

Sign In for Pricing
View Details
Hamster Beta-Crosslaps ELISA Kit
MBS107876-04 10x 96 Well

Hamster Beta-Crosslaps ELISA Kit

Sign In for Pricing
View Details
ANGEL1 Over-expression Lysate Product
GWB-44950B 0.1 mg

ANGEL1 Over-expression Lysate Product

Sign In for Pricing
View Details
SNAP25 Rabbit pAb
E2500986 100 µL

SNAP25 Rabbit pAb

Sign In for Pricing
View Details