Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Immunoglobulin lambda variable 1-36 (LV136), Biotinylated

This Recombinant Human Immunoglobulin lambda variable 1-36 (LV136), Biotinylated spans the amino acid sequence from region 20-117. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Immunoglobulin lambda variable 1-36 IGLV1-36

UniProt

A0A0B4J1U3

Expression Region

20-117

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

QSVLTQPPSVSEAPRQRVTISCSGSSSNIGNNAVNWYQQLPGKAPKLLIYYDDLLPSGVSDRFSGSKSGTSASLAISGLQSEDEADYYCAAWDDSLNG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ABCC10 siRNA (Mouse)
orb1836898-01 15 nmol

ABCC10 siRNA (Mouse)

Sign In for Pricing
View Details
ABCC10 siRNA (Mouse)
orb1836898-02 30 nmol

ABCC10 siRNA (Mouse)

Sign In for Pricing
View Details
UBE2D4 Rabbit Polyclonal Antibody (BF594)
orb2384437 100 µL

UBE2D4 Rabbit Polyclonal Antibody (BF594)

Sign In for Pricing
View Details
CD8α Antibody [K14C10]
C20794-50uL 50 μL

CD8α Antibody [K14C10]

Sign In for Pricing
View Details
Bovine GATA Binding Protein 2 ELISA Kit
MBS752061-01 48 Well

Bovine GATA Binding Protein 2 ELISA Kit

Sign In for Pricing
View Details
Bovine GATA Binding Protein 2 ELISA Kit
MBS752061-02 96 Well

Bovine GATA Binding Protein 2 ELISA Kit

Sign In for Pricing
View Details