Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Immunoglobulin heavy variable 6-1 (HV601), Biotinylated

This Recombinant Human Immunoglobulin heavy variable 6-1 (HV601), Biotinylated spans the amino acid sequence from region 21-121. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Immunoglobulin heavy variable 6-1 IGHV6-1

UniProt

A0A0B4J1U7

Expression Region

21-121

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

QVQLQQSGPGLVKPSQTLSLTCAISGDSVSSNSAAWNWIRQSPSRGLEWLGRTYYRSKWYNDYAVSVKSRITINPDTSKNQFSLQLNSVTPEDTAVYYCAR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

IFluor® 405 Anti-human CD11b Antibody *ICRF44*
10112020-AAT 100 Tests

IFluor® 405 Anti-human CD11b Antibody *ICRF44*

Sign In for Pricing
View Details
DCAF5 siRNA (Human)
CRH5814-01 15 nmol

DCAF5 siRNA (Human)

Sign In for Pricing
View Details
DCAF5 siRNA (Human)
CRH5814-02 30 nmol

DCAF5 siRNA (Human)

Sign In for Pricing
View Details
Rhob 3'UTR GFP Stable Cell Line
TU167828 1.0 mL

Rhob 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
C14orf156 Lentiviral Vector (Human) (EF1a) (pLenti-GIII-EF1a)
LV813074 1.0 µg DNA

C14orf156 Lentiviral Vector (Human) (EF1a) (pLenti-GIII-EF1a)

Sign In for Pricing
View Details
Compound NP-025206
T127706-01 10 mg

Compound NP-025206

Sign In for Pricing
View Details