Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Immunoglobulin heavy variable 3-15 (HV315), Biotinylated

This Recombinant Human Immunoglobulin heavy variable 3-15 (HV315), Biotinylated spans the amino acid sequence from region 20-119. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Immunoglobulin heavy variable 3-15 IGHV3-15

UniProt

A0A0B4J1V0

Expression Region

20-119

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

EVQLVESGGGLVKPGGSLRLSCAASGFTFSNAWMSWVRQAPGKGLEWVGRIKSKTDGGTTDYAAPVKGRFTISRDDSKNTLYLQMNSLKTEDTAVYYCTT

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

1-(((Diethylamino)oxy)carbonyl)cyclopropane-1-carbonyl Chloride
TRC-D989020-2.5G 2.5 g

1-(((Diethylamino)oxy)carbonyl)cyclopropane-1-carbonyl Chloride

Sign In for Pricing
View Details
Elab Fluor® 647 Anti-Human CD29 Antibody[TS2/16.2.1]
E-AB-F1049M-01 20 Tests

Elab Fluor® 647 Anti-Human CD29 Antibody[TS2/16.2.1]

Sign In for Pricing
View Details
Elab Fluor® 647 Anti-Human CD29 Antibody[TS2/16.2.1]
E-AB-F1049M-02 100 Tests

Elab Fluor® 647 Anti-Human CD29 Antibody[TS2/16.2.1]

Sign In for Pricing
View Details
Elab Fluor® 647 Anti-Human CD29 Antibody[TS2/16.2.1]
E-AB-F1049M-03 2x 100 Tests

Elab Fluor® 647 Anti-Human CD29 Antibody[TS2/16.2.1]

Sign In for Pricing
View Details
Tau (T377) Antibody
KC-41927-01 50 μL

Tau (T377) Antibody

Sign In for Pricing
View Details
Tau (T377) Antibody
KC-41927-02 100 µL

Tau (T377) Antibody

Sign In for Pricing
View Details