Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Immunoglobulin heavy variable 3-15 (HV315), Biotinylated

This Recombinant Human Immunoglobulin heavy variable 3-15 (HV315), Biotinylated spans the amino acid sequence from region 20-119. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Immunoglobulin heavy variable 3-15 IGHV3-15

UniProt

A0A0B4J1V0

Expression Region

20-119

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

EVQLVESGGGLVKPGGSLRLSCAASGFTFSNAWMSWVRQAPGKGLEWVGRIKSKTDGGTTDYAAPVKGRFTISRDDSKNTLYLQMNSLKTEDTAVYYCTT

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Uridine Diphosphate Choline Ammonium Salt
TRC-U829930-1MG 1 mg

Uridine Diphosphate Choline Ammonium Salt

Sign In for Pricing
View Details
1-(3-Pyridyl)-1-butanol-4-carboxylic Acid Na+/NH4+ Salt
TRC-P992550-10MG 10 mg

1-(3-Pyridyl)-1-butanol-4-carboxylic Acid Na+/NH4+ Salt

Sign In for Pricing
View Details
Epigen (EPGN) (NM_001013442) Human Over-expression Lysate
LY422978 100 µg

Epigen (EPGN) (NM_001013442) Human Over-expression Lysate

Sign In for Pricing
View Details
TMEM222 (NM_032125) Human Recombinant Protein
TP304247M 100 µg

TMEM222 (NM_032125) Human Recombinant Protein

Sign In for Pricing
View Details
Cyclin D1 (CCND1) Rabbit Polyclonal Antibody
AP06613PU-N 100 µg

Cyclin D1 (CCND1) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Tissue FFPE Sections, Endometriotic tissue
CS703430 5x 5 µm

Tissue FFPE Sections, Endometriotic tissue

Sign In for Pricing
View Details