Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Immunoglobulin heavy variable 3-15 (HV315), Biotinylated

This Recombinant Human Immunoglobulin heavy variable 3-15 (HV315), Biotinylated spans the amino acid sequence from region 20-119. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Immunoglobulin heavy variable 3-15 IGHV3-15

UniProt

A0A0B4J1V0

Expression Region

20-119

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

EVQLVESGGGLVKPGGSLRLSCAASGFTFSNAWMSWVRQAPGKGLEWVGRIKSKTDGGTTDYAAPVKGRFTISRDDSKNTLYLQMNSLKTEDTAVYYCTT

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human SLC6A5 Protein Lysate
MBS8419754-01 0.02 mg

Human SLC6A5 Protein Lysate

Sign In for Pricing
View Details
Human SLC6A5 Protein Lysate
MBS8419754-02 5x 0.02 mg

Human SLC6A5 Protein Lysate

Sign In for Pricing
View Details
StrongZyme Streptavidin-PolyHRP (High Load)
43R-1645 1 mg

StrongZyme Streptavidin-PolyHRP (High Load)

Sign In for Pricing
View Details
Lentiviral mouse Prr14 shRNA (UAS) - Lentiviral mouse Prr14 shRNA (UAS, iRFP) (25)
GTR15276422 1 Vial

Lentiviral mouse Prr14 shRNA (UAS) - Lentiviral mouse Prr14 shRNA (UAS, iRFP) (25)

Sign In for Pricing
View Details
ELISA Kit for Acyloxyacyl Hydrolase (AOAH)
TRV-0000582-01 24 Tests

ELISA Kit for Acyloxyacyl Hydrolase (AOAH)

Sign In for Pricing
View Details
ELISA Kit for Acyloxyacyl Hydrolase (AOAH)
TRV-0000582-02 48 Tests

ELISA Kit for Acyloxyacyl Hydrolase (AOAH)

Sign In for Pricing
View Details