Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Immunoglobulin heavy variable 2-26 (HV226), Biotinylated

This Recombinant Human Immunoglobulin heavy variable 2-26 (HV226), Biotinylated spans the amino acid sequence from region 20-119. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Immunoglobulin heavy variable 2-26 IGHV2-26

UniProt

A0A0B4J1V2

Expression Region

20-119

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

QVTLKESGPVLVKPTETLTLTCTVSGFSLSNARMGVSWIRQPPGKALEWLAHIFSNDEKSYSTSLKSRLTISKDTSKSQVVLTMTNMDPVDTATYYCARI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

17 alpha-propionate 25mg
A10009-25 25 mg

17 alpha-propionate 25mg

Sign In for Pricing
View Details
PPIAL4E (NM_001144032) Human Recombinant Protein
TP761470 50 µg

PPIAL4E (NM_001144032) Human Recombinant Protein

Sign In for Pricing
View Details
SURF4 3'UTR Luciferase Stable Cell Line
TU024951 1.0 mL

SURF4 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
Alpha 1 Acid Glycoprotein/ORM1 Rabbit Polyclonal Antibody (APC)
orb2617972 100 µg

Alpha 1 Acid Glycoprotein/ORM1 Rabbit Polyclonal Antibody (APC)

Sign In for Pricing
View Details
Lysmd1 3'UTR Lenti-reporter-Luc Vector
27853086 1.0 µg

Lysmd1 3'UTR Lenti-reporter-Luc Vector

Sign In for Pricing
View Details
RFX3 Protein Vector (Human) (pPB-N-His)
PV035002 500 ng

RFX3 Protein Vector (Human) (pPB-N-His)

Sign In for Pricing
View Details