Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Immunoglobulin heavy variable 3-73 (HV373), Biotinylated

This Recombinant Human Immunoglobulin heavy variable 3-73 (HV373), Biotinylated spans the amino acid sequence from region 20-119. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Immunoglobulin heavy variable 3-73 IGHV3-73

UniProt

A0A0B4J1V6

Expression Region

20-119

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

EVQLVESGGGLVQPGGSLKLSCAASGFTFSGSAMHWVRQASGKGLEWVGRIRSKANSYATAYAASVKGRFTISRDDSKNTAYLQMNSLKTEDTAVYYCTR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Polyclonal EIF5 Antibody [DyLight 755]
NBP3-00231IR 0.1 mL

Rabbit Polyclonal EIF5 Antibody [DyLight 755]

Sign In for Pricing
View Details
PKD2L1 (Polycystic Kidney Disease 2-like 1 Protein, Polycystin-2 Homolog, Polycystin-2L1, Polycystin-L, Polycystin-L1, PKD2L, PKDL, TRPP3) (MaxLight 490)
131389-ML490 100 µL

PKD2L1 (Polycystic Kidney Disease 2-like 1 Protein, Polycystin-2 Homolog, Polycystin-2L1, Polycystin-L, Polycystin-L1, PKD2L, PKDL, TRPP3) (MaxLight 490)

Sign In for Pricing
View Details
CYBA, CT (CYBA, Cytochrome b-245 light chain, Cytochrome b (558) alpha chain, Cytochrome b558 subunit alpha, Neutrophil cytochrome b 22kD polypeptide, Superoxide-generating NADPH oxidase light chain subunit, p22 phagocyte B-cytochrome, p22-phox) (MaxLight 650) discontinued
034409-ML650 100 µL

CYBA, CT (CYBA, Cytochrome b-245 light chain, Cytochrome b (558) alpha chain, Cytochrome b558 subunit alpha, Neutrophil cytochrome b 22kD polypeptide, Superoxide-generating NADPH oxidase light chain subunit, p22 phagocyte B-cytochrome, p22-phox) (MaxLight 650) discontinued

Sign In for Pricing
View Details
Dinaphtho[2,3-b:2',3'-d]furan
JH222001 1 Each

Dinaphtho[2,3-b:2',3'-d]furan

Sign In for Pricing
View Details
Cyclooxygenase 2 Rabbit pAb, PerCP-Cy7 conjugated
orb2884895 100 µL

Cyclooxygenase 2 Rabbit pAb, PerCP-Cy7 conjugated

Sign In for Pricing
View Details
Etifoxine hydrochloride 5mg
A15084-5 5 mg

Etifoxine hydrochloride 5mg

Sign In for Pricing
View Details