Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Immunoglobulin heavy variable 3-43 (HV343), Biotinylated

This Recombinant Human Immunoglobulin heavy variable 3-43 (HV343), Biotinylated spans the amino acid sequence from region 20-118. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Immunoglobulin heavy variable 3-43 IGHV3-43

UniProt

A0A0B4J1X8

Expression Region

20-118

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

EVQLVESGGVVVQPGGSLRLSCAASGFTFDDYTMHWVRQAPGKGLEWVSLISWDGGSTYYADSVKGRFTISRDNSKNSLYLQMNSLRTEDTALYYCAKD

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Ghrelin O acyltransferase (MBOAT4) Rabbit Polyclonal Antibody
TA368370 100 µL

Ghrelin O acyltransferase (MBOAT4) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Elab Fluor® 488 Anti-Human CD31 Antibody[158-2B3]
E-AB-F1050L-01 20 Tests

Elab Fluor® 488 Anti-Human CD31 Antibody[158-2B3]

Sign In for Pricing
View Details
Elab Fluor® 488 Anti-Human CD31 Antibody[158-2B3]
E-AB-F1050L-02 100 Tests

Elab Fluor® 488 Anti-Human CD31 Antibody[158-2B3]

Sign In for Pricing
View Details
Elab Fluor® 488 Anti-Human CD31 Antibody[158-2B3]
E-AB-F1050L-03 2x 100 Tests

Elab Fluor® 488 Anti-Human CD31 Antibody[158-2B3]

Sign In for Pricing
View Details
STAT5B Rabbit Monoclonal Antibody [Clone ID: R08-2I8]
TA385340 100 µL

STAT5B Rabbit Monoclonal Antibody [Clone ID: R08-2I8]

Sign In for Pricing
View Details
Tenascin C (Stromal Marker For Epithelial Malignancy) (TNC/2981R), CF647 conjugate, 0.1mg/mL
BNC472981-100 1x 100 µL

Tenascin C (Stromal Marker For Epithelial Malignancy) (TNC/2981R), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details