Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Immunoglobulin heavy variable 3-43 (HV343), Biotinylated

This Recombinant Human Immunoglobulin heavy variable 3-43 (HV343), Biotinylated spans the amino acid sequence from region 20-118. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Immunoglobulin heavy variable 3-43 IGHV3-43

UniProt

A0A0B4J1X8

Expression Region

20-118

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

EVQLVESGGVVVQPGGSLRLSCAASGFTFDDYTMHWVRQAPGKGLEWVSLISWDGGSTYYADSVKGRFTISRDNSKNSLYLQMNSLRTEDTALYYCAKD

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human zinc finger protein 655 (ZNF655) activation kit by CRISPRa
GA112321 1 Kit

Human zinc finger protein 655 (ZNF655) activation kit by CRISPRa

Sign In for Pricing
View Details
Band III (Q1/156), CF640R conjugate, 0.1mg/mL
BNC402826-100 1x 100 µL

Band III (Q1/156), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Helicobacter pylori Mouse Monoclonal Antibody [Clone ID: 3/15/45/2]
AM02032PU-S 10 µg

Helicobacter pylori Mouse Monoclonal Antibody [Clone ID: 3/15/45/2]

Sign In for Pricing
View Details
Usp14 Mouse Gene Knockout Kit (CRISPR)
KN518769 1 Kit

Usp14 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Thermal Cycler BHTC-501
BHTC-501 1 Unit

Thermal Cycler BHTC-501

Sign In for Pricing
View Details
IL1 Receptor II (IL1R2) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI3C6]
TA506802AM 100 µL

IL1 Receptor II (IL1R2) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI3C6]

Sign In for Pricing
View Details