Recombinant Human Immunoglobulin lambda variable 9-49 (LV949), Biotinylated
This Recombinant Human Immunoglobulin lambda variable 9-49 (LV949), Biotinylated spans the amino acid sequence from region 20-123. Purity: Greater than 85% as determined by SDS-PAGE.
Product Specifications
Product Name Alternative
Immunoglobulin lambda variable 9-49 IGLV9-49
UniProt
A0A0B4J1Y8
Expression Region
20-123
Origin
Homo sapiens (Human)
Endotoxin
Not test
Purity
Greater than 85% as determined by SDS-PAGE.
Form
Liquid or Lyophilized powder
Storage Conditions
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week
Notes
For research use only.
Preservative
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
AA Sequence
QPVLTQPPSASASLGASVTLTCTLSSGYSNYKVDWYQQRPGKGPRFVMRVGTGGIVGSKGDGIPDRFSVLGSGLNRYLTIKNIQEEDESDYHCGADHGSGSNFV
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
orb2365300 100 µL
Beta-Amyloid (1-42) Mouse Monoclonal Antibody (BF350)
Sign In for Pricing
View Details 
040537-ML550 100 µL
PSAPL1, NT (PSAPL1, Proactivator polypeptide-like 1, Saposin A-like, Saposin B-Val-like, Saposin B-like, Saposin C-like, Saposin D-like) (MaxLight 550) discontinued
Sign In for Pricing
View Details