Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Immunoglobulin heavy variable 3-72 (HV372), Biotinylated

This Recombinant Human Immunoglobulin heavy variable 3-72 (HV372), Biotinylated spans the amino acid sequence from region 20-119. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Immunoglobulin heavy variable 3-72 IGHV3-72

UniProt

A0A0B4J1Y9

Expression Region

20-119

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

EVQLVESGGGLVQPGGSLRLSCAASGFTFSDHYMDWVRQAPGKGLEWVGRTRNKANSYTTEYAASVKGRFTISRDDSKNSLYLQMNSLKTEDTAVYYCAR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ENTPD5 (NM_001249) Human Recombinant Protein
TP324300 20 µg

ENTPD5 (NM_001249) Human Recombinant Protein

Sign In for Pricing
View Details
CD39 (ENTPD1) Rabbit Polyclonal Antibody
TA367373 100 µL

CD39 (ENTPD1) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Bis(butoxyethyl)chlorophosphate
TRC-B410815-50MG 50 mg

Bis(butoxyethyl)chlorophosphate

Sign In for Pricing
View Details
3-Keto Fusidic Acid
TRC-K188980-2.5MG 2.5 mg

3-Keto Fusidic Acid

Sign In for Pricing
View Details
GLG1 (C-term) Rabbit Polyclonal Antibody
AP51850PU-N 400 µL

GLG1 (C-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
IFITM2 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI4E3]
TA811626BM 100 µL

IFITM2 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI4E3]

Sign In for Pricing
View Details